DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and CG31626

DIOPT Version :9

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:268 Identity:131/268 - (48%)
Similarity:143/268 - (53%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 NYG-GYSSSASSSASANSYSAPSVSY--------SAPAPAVTYSAPAPAVSYSAPAPAVTYSAPA 195
            |.| |||.: ..:.:.|..|||:.:|        ||||||..|||||||..|||||||..|||||
  Fly    22 NLGSGYSYN-KPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSAPAPAPVYSAPAPAPVYSAPA 85

  Fly   196 PAPAVTYSAPAPVVRVQAAPAVTYSAPAPAPAVTYSAPAPAPAVTYSAPAPA-----PVVRVQA- 254
            |||...|   .|.|:...|||..||||||||  .||||||||  .|||||||     ||..:.| 
  Fly    86 PAPVSEY---LPPVQDIPAPAPVYSAPAPAP--VYSAPAPAP--VYSAPAPAPEYLPPVQDIPAP 143

  Fly   255 APAVTYSAPAPAVTYSAPAPAVTYSG----------------PAPAVTYSAPAPVPVVRYSAPAP 303
            |||..|||||||..|||||||..||.                ||||..||||||.||  ||||||
  Fly   144 APAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPAPVYSAPAPAPV--YSAPAP 206

  Fly   304 APISYAPAPV-SYAPQPQSQQVVKTIKLIVDEDRAPAQVYGPPAVESSYSSASSSAAASA----- 362
            ||:..||||. .|.|..|.........:......|||.||..||....||:.:.:...||     
  Fly   207 APVYSAPAPAPEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPVE 271

  Fly   363 GGYNGGYN 370
            .||.  ||
  Fly   272 SGYQ--YN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 105/176 (60%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 105/185 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.