DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32564 and pou2af1

DIOPT Version :9

Sequence 1:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_009289855.1 Gene:pou2af1 / 103908823 -ID:- Length:248 Species:Danio rerio


Alignment Length:192 Identity:42/192 - (21%)
Similarity:67/192 - (34%) Gaps:42/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SASANSYSAPSVSYSAPAPAVTYSAP-----APAVSYSAPAPAVTYSAPAPAPAVTYSAPAPVVR 210
            |.....:.|.:.|.:|..|...::.|     .||:    |:.|..|..|. .|..|....:|::.
Zfish    75 SGLCTGWIAQTTSTTALQPLSHWTPPDCQHHDPAI----PSHADMYVQPI-CPGYTVVGSSPMLT 134

  Fly   211 VQAAPAVTYSAP-APAPAVTYSAPAPAPAVTYSAPAPAPVVRVQAAPAVTYSAPAPAVTYSAPAP 274
            ...||..|..|. :.:.:|......|..::||                :.::.|...:    |.|
Zfish   135 FAHAPLFTNLATVSTSSSVLPQVEVPDSSLTY----------------IPWAQPLSTI----PGP 179

  Fly   275 AVTYSGPAPAVTYSAPAPVPVVRYSAPAPAPI-SYAPAPVSYAPQPQSQQVVKTIKLIVDED 335
            .:..|.     ..|||...||     |...|: |..|.|....||...:..:...||:.|.:
Zfish   180 VMQASS-----ALSAPQLFPV-----PLTLPVLSPEPEPPQVEPQQAPEGTLALEKLLEDNE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 35/160 (22%)
pou2af1XP_009289855.1 PD-C2-AF1 9..246 CDD:312716 42/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.