DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and f5

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001315460.1 Gene:f5 / 327320 ZFINID:ZDB-GENE-030131-5531 Length:2087 Species:Danio rerio


Alignment Length:481 Identity:95/481 - (19%)
Similarity:152/481 - (31%) Gaps:151/481 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DNQRHPCRRDCAD--KQPMTCYYYMVVH-----YDDTMAETCKRYLQSKFRFKL-------SGKE 111
            |....|.||...:  |:.....|||...     |...|.|.    :...||.|.       .||:
Zfish   327 DEYTAPKRRLTIEQKKESQEWTYYMAAEEVIWDYAPNMPEN----MDGDFRSKYLKQGPQRIGKK 387

  Fly   112 YIDGIALATQLAANDDCKYADGLESEVM--------------VVNGQLPGMNIEVCYGDTVVADV 162
            |..  |:.||        |.||:..|..              |:..|              :.|:
Zfish   388 YKK--AVFTQ--------YKDGMFKERAEDKQRKRELGILGPVIRAQ--------------IRDI 428

  Fly   163 I-----NSMHETTTIHWHGMHQRLTPFMDGVPHVTQYP--------IEAGQAFRYRFEVDHGG-- 212
            |     |......:|:.||:      .:|.......||        ::.|:.:.|.:.|....  
Zfish   429 IKIVFKNKASRPYSIYPHGL------TIDKAAEGASYPQGGNQTYSVQPGETYTYTWSVTEEDVP 487

  Fly   213 --------TNWWHSHTEHQR--AFGLAGPLVVRMPPKLNPHAHLYDFDMSEHVIMI-----QDWV 262
                    |..:||..:..|  |.||.|||::.....||........|..:|.:..     :.|.
Zfish   488 TDSDPRCLTRMYHSAVDAPRDIASGLVGPLLICKSQSLNKKNVQLKADKEQHAMFTVFDENKSWY 552

  Fly   263 HNFVESVAENILINGRGRNLKKGVKAAKPTLYAH--FPVVRGGRYRFRVIFNGVSNCPISFSIDK 325
            .:      ||  ||....:.|| ||...|..|..  ...:.|..|.        |...:.|.   
Zfish   553 QD------EN--INTYCSDPKK-VKKDDPEFYKSNVMHTINGYVYE--------SGQELGFC--- 597

  Fly   326 HDLVV---IASDGNDIEPVEVQRIMFHG-----AERFDFVLH----ANQEVSNYWIRVKGYSFCA 378
            |..:|   ::|.|   |...:|...|:|     ..|.:.:|.    ..:.::...:.:..:...:
Zfish   598 HGEIVTWHVSSVG---EQDYIQTATFYGHTFELKNREEDILSLFPMTGETITMNMVNIGIWLLAS 659

  Fly   379 KNQLHQEAVLHYRDADTRALDTHTLSYAYDAPGK-------TLNELG------------DDASGA 424
            .|.......:..:..|......:.:.|.|: .||       |:||:.            |:.|..
Zfish   660 LNSHDSTKGMRVKFKDLECFRDYVIEYDYE-DGKFTAWKPPTINEIKKEEPVRARPDVVDEYSDL 723

  Fly   425 RAGNSISLANLNAQRPEPEVAPSVTF 450
            .| .:::|...|..:.|.|:. .:||
Zfish   724 FA-ETLNLRTFNNVKDEVEII-DLTF 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 74/396 (19%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 27/141 (19%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 27/155 (17%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972
f5NP_001315460.1 CuRO_1_FV_like 28..187 CDD:259888
CuRO_2_FV_like 199..323 CDD:259995
CuRO_3_FV_like 345..522 CDD:259992 43/210 (20%)
CuRO_4_FV_like 535..678 CDD:259996 29/165 (18%)
COG5099 823..>1247 CDD:227430
PHA03151 1124..>1228 CDD:177546
Cupredoxin 1447..1620 CDD:302766
CuRO_6_FV_like 1629..1770 CDD:259997
FA58C 1775..1924 CDD:214572
FA58C 1778..1923 CDD:238014
FA58C 1928..2084 CDD:214572
FA58C 1932..2083 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.