DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and F8

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_000123.1 Gene:F8 / 2157 HGNCID:3546 Length:2351 Species:Homo sapiens


Alignment Length:542 Identity:99/542 - (18%)
Similarity:185/542 - (34%) Gaps:169/542 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RDCADKQPMTCYYYMVVHYDD------TMAETCKRYLQSKFRFKLSGKEYIDGIALATQLAANDD 127
            |..|.|.|.|..:|:....:|      .:|...:.|   |.::..:|.:.|.......:..|..|
Human   391 RSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSY---KSQYLNNGPQRIGRKYKKVRFMAYTD 452

  Fly   128 --CKYADGLESEVMVVNGQLPGMNIEVCYGDTVVADVINSMHETTTIHWHG------MHQRLTPF 184
              .|..:.::.|..::...|.|   ||  |||::....|.......|:.||      ::.|..| 
Human   453 ETFKTREAIQHESGILGPLLYG---EV--GDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLP- 511

  Fly   185 MDGVPHVTQYPIEAGQAFRYRF--EVDHGG--------TNWWHSHTEHQR--AFGLAGPLVVRMP 237
             .||.|:..:||..|:.|:|::  .|:.|.        |.::.|....:|  |.||.|||::...
Human   512 -KGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYK 575

  Fly   238 PKLNPHAHLYDFDMSEHVIMIQDWVHNFVESVAENI---LINGRGRNLKKGVKAAKPTLYAHFPV 299
            ..::...:....| ..:||:...:..|....:.|||   |.|..|..|:.....|...:::    
Human   576 ESVDQRGNQIMSD-KRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHS---- 635

  Fly   300 VRGGRYRFRVIFNGVSNCPISFSIDKHDLVVIASDGNDIEPVEVQRIMFHGAERFDFVLHANQEV 364
                       .||.....:..|:..|::.                        :.::|....:.
Human   636 -----------INGYVFDSLQLSVCLHEVA------------------------YWYILSIGAQT 665

  Fly   365 SNYWIRVKGYSFCAKNQLHQEAVLHYRDADTRAL---DTHTLSYAYDAPGKTLNELGDDASGARA 426
            ....:...||:|  |:::..|        ||..|   ...|:..:.:.||..:  ||...|..| 
Human   666 DFLSVFFSGYTF--KHKMVYE--------DTLTLFPFSGETVFMSMENPGLWI--LGCHNSDFR- 717

  Fly   427 GNSISLANLNAQRPEPEVAPSVTFYTSMNAFEVRQGEGFRFQMDDIS-FSMPKMSLLQTRNLGVG 490
                              ...:|....:::.:...|:.:....:||| :.:.|.:.::.|:    
Human   718 ------------------NRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRS---- 760

  Fly   491 QFFCNRSQQADLGFNCRQRHCQCSNVIQVPANQQVEFVISSLSQTPHPIHLHGYTFRVVGMGVLG 555
                         |:...||         |:.:|.:|..:::.:                     
Human   761 -------------FSQNSRH---------PSTRQKQFNATTIPE--------------------- 782

  Fly   556 EQKIGQIEQID----KKTPLPR 573
                ..||:.|    .:||:|:
Human   783 ----NDIEKTDPWFAHRTPMPK 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 84/471 (18%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 33/120 (28%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 21/139 (15%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972 17/111 (15%)
F8NP_000123.1 CuRO_1_FVIII_like 22..201 CDD:259994
CuRO_2_FVIII_like 211..345 CDD:259901
CuRO_3_FVIII_like 399..575 CDD:259889 44/185 (24%)
CuRO_4_FVIII_like 588..730 CDD:259902 33/212 (16%)
B 760..1667 12/92 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..928
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..961
CuRO_5_FVIII_like 1714..1880 CDD:259890
CuRO_6_FVIII_like 1892..2035 CDD:259904
FA58C 2039..2188 CDD:214572
FA58C 2042..2187 CDD:238014
FA58C 2192..2345 CDD:214572
FA58C 2195..2344 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12110
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.