DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and F5

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_000121.2 Gene:F5 / 2153 HGNCID:3542 Length:2224 Species:Homo sapiens


Alignment Length:465 Identity:80/465 - (17%)
Similarity:156/465 - (33%) Gaps:141/465 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ESEVMVVNGQL-PGMNIEVCYGDTVVADVINSMHETTTIHWHGMHQRLTPFMDGVPHVTQ-YPIE 197
            |.....::|.| |.:..||  ||.:.....|...:..:||..|:  |.:...:|..::.. :|.|
Human    76 EKPQSTISGLLGPTLYAEV--GDIIKVHFKNKADKPLSIHPQGI--RYSKLSEGASYLDHTFPAE 136

  Fly   198 -------AGQAFRYRFEV--DHGGTN-----WWHSHTEHQRAF-----GLAGPLVVRMPPKLNPH 243
                   .|:.:.|.:.:  |.|.|:     ..|.:..|:...     ||.|||::.....|...
Human   137 KMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIEDFNSGLIGPLLICKKGTLTEG 201

  Fly   244 AHLYDFDMSEHVIMI-------QDWVHNFVESVAENILINGRGRNLKKGVKAAKPTLYAHFPV-- 299
            .....||  :.::::       :.|..:.......|..:||...::         |:.||..:  
Human   202 GTQKTFD--KQIVLLFAVFDESKSWSQSSSLMYTVNGYVNGTMPDI---------TVCAHDHISW 255

  Fly   300 ----VRGGRYRFRVIFNG---------VSNCPISFSIDKHDLVVIASDG----NDIEPVEVQRIM 347
                :..|...|.:.|||         ||...:..:......:.:..:|    :.:.|..:|..|
Human   256 HLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTVGPEGKWIISSLTPKHLQAGM 320

  Fly   348 FHGAERFDFVLHANQEVSNYWIRVKGYSFCAKNQLHQEAVLHYRDADTRALDTHTLSYAYDAPGK 412
                              ..:|.:|.   |.|...:.:.:       ||....|...:.|....:
Human   321 ------------------QAYIDIKN---CPKKTRNLKKI-------TREQRRHMKRWEYFIAAE 357

  Fly   413 TLNELGDDASGARAGNSISLANLNAQRPEPEVAPSVTFYTS--MNAFEVRQGEGFR----FQMDD 471
            .:  :.|.|       .:..||::.:            |.|  ::.|..:.|:.::    .|.:|
Human   358 EV--IWDYA-------PVIPANMDKK------------YRSQHLDNFSNQIGKHYKKVMYTQYED 401

  Fly   472 ISFSMPKMSLLQTRNLGVGQFFCNRSQQADLGFNCRQRHCQCSNVIQVPANQQVEFVISSLSQTP 536
            .||:...::             .|..:...||           .:|:......::.|..:::..|
Human   402 ESFTKHTVN-------------PNMKEDGILG-----------PIIRAQVRDTLKIVFKNMASRP 442

  Fly   537 HPIHLHGYTF 546
            :.|:.||.||
Human   443 YSIYPHGVTF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 80/465 (17%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 28/120 (23%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 22/162 (14%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972 15/79 (19%)
F5NP_000121.2 Cupredoxin 32..196 CDD:302766 28/123 (23%)
Cupredoxin 208..326 CDD:302766 20/146 (14%)
CuRO_3_FV_like 348..528 CDD:259992 24/150 (16%)
CuRO_4_FV_like 541..684 CDD:259996
B 692..1573
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 822..842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 894..927
2 X 17 AA tandem repeats 895..928
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 982..1001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1029..1048
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1097..1157
35 X 9 AA approximate tandem repeats of [TNP]-L-S-P-D-L-S-Q-T 1185..1501
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1341..1367
CuRO_5_FV_like 1579..1754 CDD:259993
Cupredoxin 1766..1902 CDD:302766
FA58C 1906..2061 CDD:214572
FA58C 1909..2060 CDD:238014
FA58C 2065..2221 CDD:214572
FA58C 2068..2220 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12110
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.