DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and F8

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_032003.2 Gene:F8 / 14069 MGIID:88383 Length:2319 Species:Mus musculus


Alignment Length:474 Identity:96/474 - (20%)
Similarity:152/474 - (32%) Gaps:157/474 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 MQMYPQLSSGAGESSQWRAAEKDNQRHPCR-------------------------RDCADKQPMT 78
            |:.|.::.| ..|.|||   :|.|......                         |..|.|.|.|
Mouse   340 MEAYVKVDS-CPEESQW---QKKNNNEEMEDYDDDLYSEMDMFTLDYDSSPFIQIRSVAKKYPKT 400

  Fly    79 CYYYMVVHYDD----------TMAETCKRYLQS----------KFRFKLSGKEYIDGIALATQLA 123
            ..:|:....:|          .......:||.:          |.||                :|
Mouse   401 WIHYISAEEEDWDYAPSVPTSDNGSYKSQYLSNGPHRIGRKYKKVRF----------------IA 449

  Fly   124 ANDDC-KYADGLESEVMVVNGQLPGMNIEVCYGDTVVADVINSMHETTTIHWHG------MHQRL 181
            ..|:. |..:.::.|..::...|.|   ||  |||::....|.......|:.||      :|.|.
Mouse   450 YTDETFKTRETIQHESGLLGPLLYG---EV--GDTLLIIFKNQASRPYNIYPHGITDVSPLHARR 509

  Fly   182 TPFMDGVPHVTQYPIEAGQAFRYRF--EVDHGG--------TNWWHS--HTEHQRAFGLAGPLVV 234
            .|  .|:.||...||..|:.|:|::  .|:.|.        |.::.|  :.|...|.||.|||::
Mouse   510 LP--RGIKHVKDLPIHPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFINPERDLASGLIGPLLI 572

  Fly   235 RMPPKLNPHAHLYDFDMSEHVIMI------QDW-----VHNFVESVAE-----------NIL--I 275
            .....::...:....| ..:||:.      |.|     :..|:.:.|:           ||:  |
Mouse   573 CYKESVDQRGNQMMSD-KRNVILFSIFDENQSWYITENMQRFLPNAAKTQPQDPGFQASNIMHSI 636

  Fly   276 NGRGRNLKKGVKAAKPTLYAHFPVVRGGRYRFRVIFNGVSNCPISFSIDKHDLVVIASDGNDIEP 340
            ||...:..:.........|.|...|........:.|:|.:        .||.:|.  .|...:.|
Mouse   637 NGYVFDSLELTVCLHEVAYWHILSVGAQTDFLSIFFSGYT--------FKHKMVY--EDTLTLFP 691

  Fly   341 VEVQRIMFHGAERFDFVLHANQEVSNYWI--------RVKGYSFCAKNQLHQEAVLHYRDADTRA 397
                   |.|...|     .:.|....|:        |.:|.:          |:|.....|...
Mouse   692 -------FSGETVF-----MSMENPGLWVLGCHNSDFRKRGMT----------ALLKVSSCDKST 734

  Fly   398 LDTHTLSYAYDAPGKTLNE 416
            .|.:...|. |.|.:.:||
Mouse   735 SDYYEEIYE-DIPTQLVNE 752

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 72/335 (21%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 34/120 (28%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 30/168 (18%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972
F8NP_032003.2 Cupredoxin 22..202 CDD:302766
Cupredoxin 212..346 CDD:302766 2/5 (40%)
CuRO_3_FVIII_like 399..575 CDD:259889 45/198 (23%)
Cupredoxin 588..730 CDD:302766 31/174 (18%)
B 760..1640
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1530..1549
Cupredoxin 1684..1848 CDD:302766
Cupredoxin 1860..2003 CDD:302766
FA58C 2008..2156 CDD:214572
FA58C 2011..2155 CDD:238014
FA58C 2160..2313 CDD:214572
FA58C 2164..2312 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.