DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and CP

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_011510737.1 Gene:CP / 1356 HGNCID:2295 Length:1094 Species:Homo sapiens


Alignment Length:635 Identity:107/635 - (16%)
Similarity:182/635 - (28%) Gaps:226/635 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RRDCADKQPMTCYYYMVVHYDDTMAETCKRYLQSKFRFKLSGKEYIDGIALATQLAANDDCKYAD 132
            |:...||:    :|.....:|    |.....|:...|...:..:.:|        ..::|.:.::
Human   570 RQKDVDKE----FYLFPTVFD----ENESLLLEDNIRMFTTAPDQVD--------KEDEDFQESN 618

  Fly   133 GLESEVMVVNGQLPGMNIEVCYGDTVV---------ADVINSMHETTTIHWHGMHQ---RLTPFM 185
            .:.|....:.|..||:.  :|.||:||         |||........|..|.|..:   .|.|..
Human   619 KMHSMNGFMYGNQPGLT--MCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQT 681

  Fly   186 DGVPHVTQYPIEAGQAFRYRFEVDH--GG------TNWWHSHTEH------QRAFGLAGPLVVRM 236
            ....|:  :|...|.........||  ||      .|.....:|.      :|.:.:|...|   
Human   682 SLTLHM--WPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEV--- 741

  Fly   237 PPKLNPHAHLYDFDMSEHVIMIQDW---VHNFVESVAENILINGRGRNLKKGVKAAKPTLYAHFP 298
                       ::|.|..    ::|   :|:..|....|..::             |...|.   
Human   742 -----------EWDYSPQ----REWEKELHHLQEQNVSNAFLD-------------KGEFYI--- 775

  Fly   299 VVRGGRYR---FRVIFNGVSNCPISFSIDKHDLVVI-----ASDGNDIEPVEVQRIMFHGAERFD 355
               |.:|:   :|...:.....|:....::..|.::     |..|:.:      :|:|..     
Human   776 ---GSKYKKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKV------KIIFKN----- 826

  Fly   356 FVLHANQEVSNYWIRVKGYSFCAKNQLHQEAVLHYRDADTRALDTHTLSYAYDAPGK-------- 412
                         :..:.||      :|...|.......|..|...||:|.:..|.:        
Human   827 -------------MATRPYS------IHAHGVQTESSTVTPTLPGETLTYVWKIPERSGAGTEDS 872

  Fly   413 ---------TLNELGDDASGARAGNSISLAN--LNAQRPEPEVAPSVTF---------YTSMNAF 457
                     |::::.|..||. .|..|....  |....|..::..::.|         |...| .
Human   873 ACIPWAYYSTVDQVKDLYSGL-IGPLIVCRRPYLKVFNPRRKLEFALLFLVFDENESWYLDDN-I 935

  Fly   458 EVRQGEGFRFQMDDISF-SMPKMSLLQTRNLG------------VGQFFCNRSQQADLGFNCRQR 509
            :.......:...||..| ...||..:..|..|            |..:......:.||       
Human   936 KTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDL------- 993

  Fly   510 HCQCSNVIQVPANQQVEFVISSLSQTPHPIHLHGYTFRVVGMGVLGEQKIGQIEQIDKKTPLPRR 574
                                       |.:|.||::|:....||..                   
Human   994 ---------------------------HTVHFHGHSFQYKHRGVYS------------------- 1012

  Fly   575 AKGAPLKDSVQVPAFGYTILRFYSNSPGYWMFHCHISPHSENGMAAVVRV 624
                  .|...:....|..|..:..:||.|:.|||::.|...||.....|
Human  1013 ------SDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTV 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 97/571 (17%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 29/128 (23%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 19/147 (13%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972 30/170 (18%)
CPXP_011510737.1 CuRO_1_ceruloplasmin 22..202 CDD:259884
CuRO_2_ceruloplasmin 214..354 CDD:259907
CuRO_3_ceruloplasmin 369..572 CDD:259886 1/1 (100%)
CuRO_4_ceruloplasmin 575..718 CDD:259908 34/162 (21%)
CuRO_5_ceruloplasmin 732..902 CDD:259887 36/237 (15%)
CuRO_6_ceruloplasmin 913..1057 CDD:259898 33/204 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12110
eggNOG 1 0.900 - - E1_COG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11709
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.