DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and LOC105947063

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_031757176.1 Gene:LOC105947063 / 105947063 -ID:- Length:587 Species:Xenopus tropicalis


Alignment Length:144 Identity:32/144 - (22%)
Similarity:39/144 - (27%) Gaps:63/144 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 GFNCRQRHCQCSNVIQVPANQQVEFVISSLSQTPHPIHLHGYTFRVVGMGVLGEQKIGQIEQIDK 567
            |..|.|..|.|:               |:|.....|....||.       |:||...||.     
 Frog    93 GSCCPQYKCVCN---------------SNLCVMAFPTCQTGYE-------VVGEYVKGQC----- 130

  Fly   568 KTPLPRRAKGAPLKDSVQVPA-FGYTILRFYSNSPGYWMFHCHISPHSENGMAAVVRVGEDVEMK 631
             .|..:.|....|..:||:.. .||.:                              |.|.||..
 Frog   131 -CPYYKCACNLKLCPTVQLDCMIGYEV------------------------------VSEHVEES 164

  Fly   632 MCP----VSNCGLC 641
            .||    |.|..||
 Frog   165 CCPHNKCVCNVSLC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 23/123 (19%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927
CuRO_2_tcLCC_insect_like 253..390 CDD:259951
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972 26/130 (20%)
LOC105947063XP_031757176.1 GHB_like 500..579 CDD:419725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257925at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.