DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and LOC105945636

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_031756449.1 Gene:LOC105945636 / 105945636 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:151 Identity:29/151 - (19%)
Similarity:44/151 - (29%) Gaps:69/151 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PLVVRMPPKLNPHAHLYDFDMSEHVIMIQDWVHNFVESVAENILINGRGRNLKKGVKAAKPTLYA 295
            |:.||...:..|.:|:|    ||:               .||.|....|.|              
 Frog   149 PVCVRGNAEYLPGSHVY----SEN---------------CENCLCAQNGNN-------------- 180

  Fly   296 HFPVVRGGRYRFRVIFNGV---SNCPISFSIDKHD-----------LVVIASDGNDIEPVEVQRI 346
                       |.:..|.|   .:||..|.:.|:.           ..|:..||:       .|:
 Frog   181 -----------FTIACNPVVCNIHCPAGFKVKKNSPSDCCGTCQQTNCVVKYDGS-------YRL 227

  Fly   347 MFHGAERFDFVLHANQEVSNY 367
            |.:|    |.:...|...:.|
 Frog   228 MNNG----DVLPSMNDNCTMY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 29/151 (19%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 1/3 (33%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 22/129 (17%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972
LOC105945636XP_031756449.1 CT 295..378 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257925at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.