DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mco4 and f5

DIOPT Version :9

Sequence 1:NP_573249.1 Gene:Mco4 / 326221 FlyBaseID:FBgn0052557 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_002935820.2 Gene:f5 / 100135376 XenbaseID:XB-GENE-987398 Length:2011 Species:Xenopus tropicalis


Alignment Length:501 Identity:97/501 - (19%)
Similarity:174/501 - (34%) Gaps:171/501 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 QRLTPFMDG-----VPHVTQYPIEA-----GQAFRY------RFEVDHGGTNWWHSHTEHQRAFG 227
            ::|.|:.:.     :|:.|.:.:|.     |.:..|      ..::|...|.   |.||.:..||
 Frog  1135 EKLIPYFNDSNLNLLPNRTSHSLEESKLPNGNSNNYGNQTAATRDIDSPETK---SDTEFRELFG 1196

  Fly   228 ---LAGPLVVRMPPKLNPHAHLYDFDMSEHVIMIQDWVHNFVESV--AENILINGRGRNLKKGVK 287
               ..|.:.|....|     .:.:.:|.:|::..:    |..|||  ..:.|.|.:   .::...
 Frog  1197 QQIFEGIMQVIFYQK-----EVNETNMEQHLVTEE----NSTESVQNESHTLFNNK---TQEEQN 1249

  Fly   288 AAKPTLYAHFPVVRGGRYR-----FRVIFN-----GVSNCPIS--------FS------------ 322
            |.|||  ..:..||..|||     .|::..     |..|..:|        ||            
 Frog  1250 AKKPT--KRYFQVRPIRYRTSSNETRMLTRRKKRLGNVNGSLSNDTGNDGVFSPRGMRPQIIIGL 1312

  Fly   323 --IDKHDLVVIASDGNDIEPVEVQRIMFHGAERFDFVLHANQE--VSNYWIRVKGYSFCAKNQLH 383
              :|:.|.|.:..|..| |.|.::::.:....:.:...:.|.:  :..|...:||    .|.:  
 Frog  1313 PGLDEGDYVELNVDEID-EDVHIKKVEYEELYKTEAQEYTNPDKIIQQYLRSLKG----KKRK-- 1370

  Fly   384 QEAVLHYRDADTRALDTHTLSYAYDAPGKTLNELGDDASGARAGNSISLANLNAQRPEPEVAPSV 448
                 :|..|:....|       |..|.|                    ::|..:||:.|.  ..
 Frog  1371 -----YYITAEEEQWD-------YYNPAK--------------------SSLTKERPDSET--RT 1401

  Fly   449 TFYTSMNAFEVRQGEGFRFQMDDISFSMPKMSLLQTRNLGVGQFFCNRSQQADLGFNCRQRHCQC 513
            |.||.:.         || |..|.|||.|.:......:||:            ||          
 Frog  1402 TQYTKVR---------FR-QYLDSSFSKPDVQGEYEEHLGI------------LG---------- 1434

  Fly   514 SNVIQVPANQQVEFVISSLSQTPHPIHLHGYTFRVVGMGVLGEQKIGQIEQIDKKTPLPRRAKGA 578
             .||:...:..::....:|:..|:.:|.||.::          :|..:..|.|..||...:    
 Frog  1435 -PVIRAEVDDIIQITFKNLASRPYSLHAHGVSY----------EKSSEGFQYDDGTPDWLK---- 1484

  Fly   579 PLKDSVQVPAFGYTILRF--YSNSP-------GYWMFHCHISPHSE 615
              ||....|...||.:.:  :.::|       ..|:::..::|..:
 Frog  1485 --KDDAVKPGETYTYVWYATHQSAPENEGSDCRTWIYYSGVNPEKD 1528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mco4NP_573249.1 ascorbase 132..626 CDD:274555 97/501 (19%)
CuRO_1_tcLCC2_insect_like 132..235 CDD:259927 15/74 (20%)
CuRO_2_tcLCC_insect_like 253..390 CDD:259951 34/172 (20%)
CuRO_3_tcLLC2_insect_like 468..633 CDD:259972 30/157 (19%)
f5XP_002935820.2 CuRO_1_FV_like 32..192 CDD:259888
CuRO_2_FV_like 204..326 CDD:259995
CuRO_3_FV_like 348..514 CDD:259992
CuRO_4_FV_like 527..666 CDD:259996
PTZ00112 775..>1084 CDD:240274
235kDa-fam <938..>1249 CDD:130673 25/128 (20%)
CuRO_5_FV_like 1368..1543 CDD:259993 46/246 (19%)
CuRO_6_FV_like 1555..1694 CDD:259997
FA58C 1702..1849 CDD:238014
FA58C 1857..2008 CDD:238014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11920
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.