DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32488 and CG17294

DIOPT Version :9

Sequence 1:NP_001286926.1 Gene:CG32488 / 326220 FlyBaseID:FBgn0052488 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster


Alignment Length:259 Identity:52/259 - (20%)
Similarity:102/259 - (39%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TFESVILDADGVLWHFSKAIDGAVDTFNYMNTTGRKIFIISNNSEISRQEMADKAKGFGIEIKED 87
            :.:..::|..|.|....:....||:....:..:|..:..::|.::.|:..:.::....|.::...
  Fly     2 SIKGALIDLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDAS 66

  Fly    88 NVLTSSFSCANFLAVKNFQKKVFVMGEKGVHFELEKFGICSLKMSEKLEKPMHEFVTELELDPDV 152
            .:.:|..:..:           :|..|:     |..:.|.|       |....:|..|     |.
  Fly    67 EIYSSLSAAVS-----------YVENER-----LNPYYILS-------EDARQDFPPE-----DT 103

  Fly   153 ----GAVIVG-RDEGFNMAKLVRTGSYLLNPDVIFLGTCLDAAYPIGNNRVMVGAGATLAAMKAY 212
                .:|::| ..:.||..:|....:.||......|.......|......:.:|.|..:..::..
  Fly   104 RRYKDSVVIGLAPKAFNYEQLNEAFNVLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFA 168

  Fly   213 TGRSPLVLGKPNPWMASTLMQSGAI---KPETTLMVGDTLQTDMHFASNCGFQSLMVGSGVNTP 273
            |||:..|:|||||:..     .||:   .|.:.:|:||....|:..|.:.|.|.::|.:|...|
  Fly   169 TGRTAKVIGKPNPYFF-----EGALAGRDPASCVMIGDDANDDIVGAMSMGMQGILVKTGKYLP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32488NP_001286926.1 PGP_euk 23..300 CDD:273635 52/259 (20%)
Hydrolase_6 27..127 CDD:290083 13/99 (13%)
Hydrolase_like 219..285 CDD:289983 19/58 (33%)
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 52/258 (20%)
Hydrolase_6 7..98 CDD:290083 16/113 (14%)
DUF843 <84..136 CDD:114536 14/63 (22%)
Hydrolase_like 175..245 CDD:289983 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.