DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32488 and Nipsnap

DIOPT Version :9

Sequence 1:NP_001286926.1 Gene:CG32488 / 326220 FlyBaseID:FBgn0052488 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001285316.1 Gene:Nipsnap / 32573 FlyBaseID:FBgn0030724 Length:273 Species:Drosophila melanogaster


Alignment Length:127 Identity:23/127 - (18%)
Similarity:47/127 - (37%) Gaps:42/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 VKNFQKKVFVMGEKGVHFELEKFGICSLKMSEKLEKPMH------------EFVTELELDPDVGA 154
            :.|::..|.::.||..:...|.....::::.: :::.:|            :...:|..||:..:
  Fly    76 LNNYKTTVALINEKKANLSCELVASWTVQVGD-MDQCLHLWKYTGGFEKIDQAKEDLWNDPEYLS 139

  Fly   155 VIVGRDEGFNMAKL-------------VRTG-------SYLLNPDVIFLGTCLDAAYPIGNN 196
            ::..|.:......|             .|||       ||.|.|     ||.::    .|||
  Fly   140 LMQERSKFLRSRHLQYLLAFSYWPQIASRTGKNIYEMRSYRLTP-----GTMIE----WGNN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32488NP_001286926.1 PGP_euk 23..300 CDD:273635 23/127 (18%)
Hydrolase_6 27..127 CDD:290083 5/24 (21%)
Hydrolase_like 219..285 CDD:289983
NipsnapNP_001285316.1 NIPSNAP 174..271 CDD:285252 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.