DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32488 and Hdhd5

DIOPT Version :9

Sequence 1:NP_001286926.1 Gene:CG32488 / 326220 FlyBaseID:FBgn0052488 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006237308.2 Gene:Hdhd5 / 312680 RGDID:1306557 Length:423 Species:Rattus norvegicus


Alignment Length:310 Identity:62/310 - (20%)
Similarity:114/310 - (36%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TFESVILDADGVLWHFSKAIDGAVDTFN-YMNTTGR---KIFIISNNSEISRQEMADKAKGFGIE 83
            || .::.|.||||....:.|..|::.|: .:|:.|:   .:..::|...|.:::.|.:.... :|
  Rat    46 TF-GLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLQVPVVFVTNAGNILQRDKAQELSAL-LE 108

  Fly    84 IK--EDNVLTSSFSCANFLAVKNFQKKVFVMGE-------KGVHFE-----------LEKFGICS 128
            .|  .|.|:.|......||...|  |::.|.|:       :.:.|:           ..:..:..
  Rat   109 CKVDPDQVILSHSPMKLFLQYHN--KRMLVSGQGPLVENARALGFQNVVTVDDLRIAFPELDMVD 171

  Fly   129 LKMSEKL----EKPMHEF---------------VTELELDPDVGAVIVGRDEGFNMAKLVRTGSY 174
            |:...|.    .:|..:|               .|.|:|..||  ::.....|..:|    |..|
  Rat   172 LQRRPKTMVIRTRPRSDFPAIEGVLLLGEPVRWETNLQLITDV--LLSNGHPGAGLA----TAPY 230

  Fly   175 LLNPDVIFLGTCLDAAYPIGNNRVMVGAGATLAAMKA-----------YTGRSPLVLGKPN---- 224
               |.:..|.:.:|..:....:....|.|..|..::.           |.|    ::|||:    
  Rat   231 ---PHLPVLASNMDLLWMAEASMPRFGHGTFLLCLETIYRKITGHELKYEG----LMGKPSILTY 288

  Fly   225 PWMASTLMQS----GAIKPETTL-MVGDTLQTDMHFASNCGFQSLMVGSG 269
            .:....:.|.    |...|...| .:||...:|: :.:|...|.|.:.:|
  Rat   289 RYAEEVIRQQAERRGWAAPIRKLYAIGDNPMSDV-YGANLFHQYLQMANG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32488NP_001286926.1 PGP_euk 23..300 CDD:273635 62/310 (20%)
Hydrolase_6 27..127 CDD:290083 25/123 (20%)
Hydrolase_like 219..285 CDD:289983 14/60 (23%)
Hdhd5XP_006237308.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.