powered by:
Protein Alignment CG32488 and NIPSNAP2
DIOPT Version :9
Sequence 1: | NP_001286926.1 |
Gene: | CG32488 / 326220 |
FlyBaseID: | FBgn0052488 |
Length: | 307 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001474.1 |
Gene: | NIPSNAP2 / 2631 |
HGNCID: | 4179 |
Length: | 286 |
Species: | Homo sapiens |
Alignment Length: | 48 |
Identity: | 11/48 - (22%) |
Similarity: | 23/48 - (47%) |
Gaps: | 9/48 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 FVTELELDPDVGAVIVGRDEGFNMAKLVRTGSYLLNPDVIFLGTCLDA 189
||.:::...|..:.::.:.|..|:.|| ..:.:.|: ||:|
Human 50 FVRKVDPRKDAHSNLLAKKETSNLYKL---QFHNVKPE------CLEA 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R944 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.