DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32488 and Hdhd5

DIOPT Version :9

Sequence 1:NP_001286926.1 Gene:CG32488 / 326220 FlyBaseID:FBgn0052488 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_659064.1 Gene:Hdhd5 / 214932 MGIID:2136976 Length:419 Species:Mus musculus


Alignment Length:363 Identity:75/363 - (20%)
Similarity:130/363 - (35%) Gaps:106/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TFESVILDADGVLWHFSKAIDGAVDTFN-YMNTTGR---KIFIISNNSEI----SRQEMADKAKG 79
            || .::.|.||||....:.|..|::.|: .:|:.|:   .:..::|...|    ..||::|..: 
Mouse    46 TF-GLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLRVPVVFVTNAGNILQHNKAQELSDLLR- 108

  Fly    80 FGIEIKEDNVLTSSFSCANFLAVKNFQKKVFVMGEKGVHFELEKFGICSLKMSEKLEKPMHEF-V 143
              .::..|.|:.|......||  :...|::.|.|:..:.......|..::...::|.....|. :
Mouse   109 --CKVDPDQVILSHSPMKLFL--QYHSKQMLVSGQGPLVENARALGFQNVVTIDELRLAFPELDM 169

  Fly   144 TELELDPDV-----------GAVIVGRDEGFNMAKLVRTGSYL-LNPDVIFL----GTCL-DAAY 191
            .:|:..|..           |.:::|..        ||..:.| |..||:..    ||.| .|.|
Mouse   170 VDLQRRPKTMRLRSDFPAIEGVLLLGEP--------VRWETNLQLIMDVLLSNGHPGTGLATAPY 226

  Fly   192 P----IGNNRVMV----------GAGATLAAMKA-----------YTGRSPLVLGKPN----PWM 227
            |    :.:|..::          |.|..|..::.           |.|    ::|||:    .:.
Mouse   227 PHLPVLASNMDLLWMAEAKMPRFGHGTFLLCLETIYRKITGNELKYEG----LMGKPSILTYQYA 287

  Fly   228 ASTLMQS----GAIKPETTL-MVGDTLQTDMHFASNCGFQSLMVGSGVNTPKEVQQ--------- 278
            ...:.|.    |...|...| .:||...:|: :.:|...|.|.:   .|..:|.||         
Mouse   288 EDVIRQQAERRGWAAPIRKLYAIGDNPMSDV-YGANLFHQYLQM---ANRGEEEQQTGGQQKQRP 348

  Fly   279 --------------IIEEGDPKKKILVPD-TYLPSLGH 301
                          |....||..::..|. ..||..||
Mouse   349 SATQSCASILVCTGIYSSQDPGSQVPPPGRRELPFHGH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32488NP_001286926.1 PGP_euk 23..300 CDD:273635 73/360 (20%)
Hydrolase_6 27..127 CDD:290083 24/107 (22%)
Hydrolase_like 219..285 CDD:289983 18/97 (19%)
Hdhd5NP_659064.1 CECR5 47..358 CDD:200106 66/332 (20%)
Hydrolase_6 49..152 CDD:290083 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.