DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sk2 and Sphk2

DIOPT Version :10

Sequence 1:NP_647762.3 Gene:Sk2 / 326219 FlyBaseID:FBgn0052484 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_064395.2 Gene:Sphk2 / 56632 MGIID:1861380 Length:617 Species:Mus musculus


Alignment Length:111 Identity:24/111 - (21%)
Similarity:48/111 - (43%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NKMGERFSVVTTISPFYDDDGLLIGIICITNDSALFQRPRVPPAKNRWQEGDSSFCRGTNGVASR 116
            ||.|:..|    ::.....|..::.::.:|...||:   ...|..|.|::.:   ..||..|.:|
Mouse     5 NKAGQLMS----LAALQQHDPYIVKLLDVTGQVALY---TFNPKANEWEKNE---IEGTLFVYAR 59

  Fly   117 L-----GFDSKEAVVSKLGLDS-QQPIQAAIASKISD--LASKVGN 154
            .     ||    .::::|..:: .:||...:..::.|  |..:.||
Mouse    60 SASPHHGF----TIMNRLSTENLVEPINKDLEFQLQDPFLLYRNGN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sk2NP_647762.3 PLN02958 <213..639 CDD:215517
Sphk2NP_064395.2 Required for binding to sulfatide and phosphoinositides and for membrane localization. /evidence=ECO:0000250|UniProtKB:Q9NRA0 1..140 24/111 (22%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:12954646 87..95 1/7 (14%)
PLN02958 <142..608 CDD:215517
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..472
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q9NRA0 381..390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.