DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sk2 and tim54

DIOPT Version :9

Sequence 1:NP_647762.3 Gene:Sk2 / 326219 FlyBaseID:FBgn0052484 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_596696.1 Gene:tim54 / 2540096 PomBaseID:SPBC1347.04 Length:347 Species:Schizosaccharomyces pombe


Alignment Length:191 Identity:36/191 - (18%)
Similarity:63/191 - (32%) Gaps:65/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RTLEEIFVAPTVDERRRRVLVLLNPKSGSG--DAREVFNMHVTPVLNEAEVPYDLYVTKHSNFAI 261
            |.|.:..:||.  |..|::.|.|:...|.|  .|||.|..::.|:.|.|.:.::...:|      
pombe    47 RHLADQPMAPL--ELPRKLKVYLHGPPGDGIYVAREEFEEYIRPIFNAAAIEFETVESK------ 103

  Fly   262 EFLSTRCLDAWCCVVAVGGDGLFHEIVNGLLQRQDWAHVLPHLALGIIPCGSGNGLARSIAHCYN 326
                                                              |.||.|.:.....||
pombe   104 --------------------------------------------------GEGNLLEQVARTVYN 118

  Fly   327 EPYFSKPVLGAALTVISGRSSPMDVVRVQLQSR-SLYSFL-SIGWGLISDV---DIESERI 382
            :.:....|......::|.....:|...:.|..| :|..|| .:.:|...|:   .:|:|::
pombe   119 KRHNISEVSEPEKNLLSVLKPSVDPPAIVLLGRHALKEFLYGVRYGFSDDIMKRKLETEKL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sk2NP_647762.3 PLN02958 <213..639 CDD:215517 31/177 (18%)
DAGK_cat 216..354 CDD:279163 21/139 (15%)
tim54NP_596696.1 Tim54 10..323 CDD:288548 36/191 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12358
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.