DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and ATX1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_014140.1 Gene:ATX1 / 855462 SGDID:S000005203 Length:73 Species:Saccharomyces cerevisiae


Alignment Length:59 Identity:27/59 - (45%)
Similarity:41/59 - (69%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            ::|.|.|||.||:.||.:||.||...|.|::|:||.:.|.|.:.|..|.::|:::||||
Yeast     7 YQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGK 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 25/56 (45%)
ATX1NP_014140.1 HMA 13..68 CDD:238219 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I2668
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I1787
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto99464
orthoMCL 1 0.900 - - OOG6_103475
Panther 1 1.100 - - LDO PTHR46365
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R124
SonicParanoid 1 1.000 - - X3080
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.