DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and Atox1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_445811.1 Gene:Atox1 / 84355 RGDID:621684 Length:68 Species:Rattus norvegicus


Alignment Length:70 Identity:39/70 - (55%)
Similarity:48/70 - (68%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
            |..|||.|:|||||||.||.|||.|||. || .||:|.::.|.:.|..|||.|:..|.||||:.:
  Rat     1 MPKHEFSVDMTCGGCAEAVSRVLNKLGG-VE-FNIDLPNKKVCIESEHSSDILLATLNKTGKAVS 63

  Fly    66 YVGVK 70
            |:|.|
  Rat    64 YLGPK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 32/56 (57%)
Atox1NP_445811.1 HMA 5..63 CDD:238219 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11007
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5220
OMA 1 1.010 - - QHG50019
OrthoDB 1 1.010 - - D1564517at2759
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto96707
orthoMCL 1 0.900 - - OOG6_103475
Panther 1 1.100 - - LDO PTHR46365
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.