DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT1G63950

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001323353.1 Gene:AT1G63950 / 842698 AraportID:AT1G63950 Length:116 Species:Arabidopsis thaliana


Alignment Length:57 Identity:15/57 - (26%)
Similarity:27/57 - (47%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ERVLGKLGDKVEKV------NINLEDRTVSVTSNLSSDELMEQLRK---TGKSTTYV 67
            :|..||:...:..:      .::|::.|:.|..::...||:..|||   ..|.|.||
plant    13 QRSKGKITKSISDLPGIHSSYMDLKEGTLVVMGDVDPVELVRNLRKKWGKAKLTLYV 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 11/49 (22%)
AT1G63950NP_001323353.1 HMA 9..58 CDD:459804 9/44 (20%)

Return to query results.
Submit another query.