DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT5G24580

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_568449.1 Gene:AT5G24580 / 832529 AraportID:AT5G24580 Length:319 Species:Arabidopsis thaliana


Alignment Length:55 Identity:15/55 - (27%)
Similarity:31/55 - (56%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            |::.|.|||..:||.:.|:.. ||:|.:::.:..|::...|....:..:::|..|
plant    62 VDLHCVGCAKKIERSILKIRG-VEEVVMDMNENQVTIKGVLDPQAVCNKIKKKTK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 14/52 (27%)
AT5G24580NP_568449.1 HMA 62..113 CDD:459804 13/51 (25%)
HMA 151..197 CDD:459804
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.