DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT5G23760

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_568436.1 Gene:AT5G23760 / 832441 AraportID:AT5G23760 Length:103 Species:Arabidopsis thaliana


Alignment Length:45 Identity:10/45 - (22%)
Similarity:26/45 - (57%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            |:|......|  |:.:..:::|:.::|...:.:..::::|:|.||
plant    21 AIEAAADIFG--VDSIAADMKDQKLTVIGLMDAVAVVKKLKKVGK 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 8/42 (19%)
AT5G23760NP_568436.1 None

Return to query results.
Submit another query.