DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT5G03380

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_195958.1 Gene:AT5G03380 / 831854 AraportID:AT5G03380 Length:392 Species:Arabidopsis thaliana


Alignment Length:57 Identity:15/57 - (26%)
Similarity:30/57 - (52%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQL 57
            :|....|::|.|.||...::|:. |....||.|.|:.:...::|..|:...|:.:::
plant    23 ITTVVMKLDMHCEGCGKKIKRIF-KHFKGVEDVKIDYKSNKLTVIGNVDPVEVRDKV 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 15/57 (26%)
AT5G03380NP_195958.1 HMA 26..83 CDD:459804 14/54 (26%)
HMA 162..217 CDD:459804
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.