DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT4G27590

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001154271.1 Gene:AT4G27590 / 828869 AraportID:AT4G27590 Length:332 Species:Arabidopsis thaliana


Alignment Length:69 Identity:14/69 - (20%)
Similarity:32/69 - (46%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGV 69
            |..|.:...||...|:|.|..| ..:..|.::..::.|:|....:..:::..::|..|...:..|
plant    19 EMMVPLYSYGCEKKVKRALSHL-KGIYSVKVDYYNQKVTVWGICNKLDVLAMVKKKRKEARFWNV 82

  Fly    70 KKXD 73
            ::.:
plant    83 EEEE 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 12/55 (22%)
AT4G27590NP_001154271.1 HMA 19..78 CDD:238219 13/59 (22%)

Return to query results.
Submit another query.