DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT4G08570

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_192597.1 Gene:AT4G08570 / 826418 AraportID:AT4G08570 Length:150 Species:Arabidopsis thaliana


Alignment Length:52 Identity:15/52 - (28%)
Similarity:30/52 - (57%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CGGCASAVERVLGKLGDK-VEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            |.||...::.||.  |.| |:.|:::::.:.|:||..:...:::|..:.|.|
plant    37 CEGCERKIKHVLS--GVKGVKSVDVDVKLQKVTVTGYIDPKKVLEAAKSTKK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 13/49 (27%)
AT4G08570NP_192597.1 HMA 30..89 CDD:238219 15/52 (29%)

Return to query results.
Submit another query.