DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and CCH

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001326128.1 Gene:CCH / 824790 AraportID:AT3G56240 Length:121 Species:Arabidopsis thaliana


Alignment Length:68 Identity:27/68 - (39%)
Similarity:44/68 - (64%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKK 71
            ||.|:|.||..||.|||||: :.||..:|:::::.|:|..|:..:.:.:.:.||||.|:|..|:.
plant     8 KVGMSCQGCVGAVNRVLGKM-EGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSYWPVEA 71

  Fly    72 XDE 74
            ..|
plant    72 EAE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 21/54 (39%)
CCHNP_001326128.1 HMA 10..65 CDD:238219 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4256
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103475
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.