DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT3G24450

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_566747.1 Gene:AT3G24450 / 822035 AraportID:AT3G24450 Length:140 Species:Arabidopsis thaliana


Alignment Length:55 Identity:21/55 - (38%)
Similarity:30/55 - (54%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRK 59
            |.||.|.|.|||..||:.:.|| |.|....:.||.:.|.|..|:...:::|.:.|
plant    77 ELKVSMHCYGCAKKVEKHISKL-DGVTWYKVELESKKVVVKGNILPVDVLESICK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 21/55 (38%)
AT3G24450NP_566747.1 HMA 77..130 CDD:238219 20/53 (38%)

Return to query results.
Submit another query.