DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT3G06130

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_566273.1 Gene:AT3G06130 / 819786 AraportID:AT3G06130 Length:473 Species:Arabidopsis thaliana


Alignment Length:94 Identity:25/94 - (26%)
Similarity:45/94 - (47%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEF--------KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQL 57
            |:..||        ||.:.|.||...|:::|.|: :.|....|:.|...|:|:.::....|:::|
plant     1 MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKI-EGVFTTKIDSEQGKVTVSGSVDPSVLIKKL 64

  Fly    58 RKTGKSTTYVGVKKXDEFLSKFQKYGRLK 86
            .|:||.....|..| :...::.|...:.|
plant    65 AKSGKHAEIWGAPKGNNNPNQSQMANQFK 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 19/67 (28%)
AT3G06130NP_566273.1 HMA 13..72 CDD:238219 18/59 (31%)

Return to query results.
Submit another query.