DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT3G05220

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_187173.2 Gene:AT3G05220 / 819686 AraportID:AT3G05220 Length:577 Species:Arabidopsis thaliana


Alignment Length:62 Identity:21/62 - (33%)
Similarity:35/62 - (56%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVG 68
            ||.:.|.||...|::.|.|: :.|..|..::|...|:||.|:....|:::|.|:||....:|
plant    15 KVNVHCEGCKHKVKKQLQKI-EGVYSVKADVEQGRVTVTGNIDPALLVKKLSKSGKHAEILG 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 18/53 (34%)
AT3G05220NP_187173.2 HMA 13..72 CDD:238219 20/57 (35%)

Return to query results.
Submit another query.