DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and NAKR2

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_181275.2 Gene:NAKR2 / 818315 AraportID:AT2G37390 Length:259 Species:Arabidopsis thaliana


Alignment Length:53 Identity:15/53 - (28%)
Similarity:29/53 - (54%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRK 59
            ||.:.|.||...|.:.|.:: ..|...||:...:.|:||.:::..|:::.:.|
plant   186 KVSLHCRGCEGKVRKHLARM-QGVTSFNIDFAAKKVTVTGDITPLEILDSISK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 15/53 (28%)
NAKR2NP_181275.2 HMA 184..237 CDD:238219 14/51 (27%)

Return to query results.
Submit another query.