DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and AT2G36950

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_565855.1 Gene:AT2G36950 / 818269 AraportID:AT2G36950 Length:386 Species:Arabidopsis thaliana


Alignment Length:83 Identity:24/83 - (28%)
Similarity:36/83 - (43%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQL-----RKT----- 60
            :||:|.|.|||..::|:: |..|.|:.|..:.....:.|...:...:|.|:|     ||.     
plant    54 YKVDMHCEGCAKKIKRMV-KHFDGVKDVTADTGGNKLLVVGKIDPVKLQEKLEEKTKRKVVLANP 117

  Fly    61 -----GKSTTYVGVKKXD 73
                 |.....||.|| |
plant   118 PPKVEGPVAAAVGEKKAD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 18/69 (26%)
AT2G36950NP_565855.1 HMA 53..106 CDD:459804 16/52 (31%)

Return to query results.
Submit another query.