DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and atox1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001039238.1 Gene:atox1 / 734100 XenbaseID:XB-GENE-947767 Length:68 Species:Xenopus tropicalis


Alignment Length:71 Identity:35/71 - (49%)
Similarity:47/71 - (66%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKL-GDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKST 64
            |:..||.|:|||.|||:||.|||.:| |.:.|   |:|.::.|...|:||.|.|:|.|:||||..
 Frog     1 MSKKEFFVDMTCEGCANAVNRVLSRLEGVQYE---IDLPNKKVVTESDLSVDLLLETLKKTGKEA 62

  Fly    65 TYVGVK 70
            .|:|.|
 Frog    63 KYLGCK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 29/57 (51%)
atox1NP_001039238.1 HMA 10..63 CDD:238219 28/55 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11433
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5220
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564517at2759
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto103414
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R124
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.