powered by:
Protein Alignment Atox1 and atox1
DIOPT Version :9
Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001039238.1 |
Gene: | atox1 / 734100 |
XenbaseID: | XB-GENE-947767 |
Length: | 68 |
Species: | Xenopus tropicalis |
Alignment Length: | 71 |
Identity: | 35/71 - (49%) |
Similarity: | 47/71 - (66%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTVHEFKVEMTCGGCASAVERVLGKL-GDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKST 64
|:..||.|:|||.|||:||.|||.:| |.:.| |:|.::.|...|:||.|.|:|.|:||||..
Frog 1 MSKKEFFVDMTCEGCANAVNRVLSRLEGVQYE---IDLPNKKVVTESDLSVDLLLETLKKTGKEA 62
Fly 65 TYVGVK 70
.|:|.|
Frog 63 KYLGCK 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
29/57 (51%) |
atox1 | NP_001039238.1 |
HMA |
10..63 |
CDD:238219 |
28/55 (51%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I11433 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
61 |
1.000 |
Inparanoid score |
I5220 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564517at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005753 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103414 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R124 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3080 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.090 |
|
Return to query results.
Submit another query.