powered by:
Protein Alignment Atox1 and AT3G56891
DIOPT Version :9
Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001118849.1 |
Gene: | AT3G56891 / 6240272 |
AraportID: | AT3G56891 |
Length: | 166 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 42/66 - (63%) |
Gaps: | 1/66 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
:::.|..|:|.|.||...|.|.:.|| |.|:.|.|:::.:.|:||..:..:|:::.:::||::..
plant 15 LSIVELLVDMDCKGCEKKVRRAISKL-DGVDTVEIDVDRQKVTVTGYVDREEVLKMVKRTGRTAE 78
Fly 66 Y 66
|
plant 79 Y 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
19/56 (34%) |
AT3G56891 | NP_001118849.1 |
HMA |
24..78 |
CDD:238219 |
18/54 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1603 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.770 |
|
Return to query results.
Submit another query.