DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and atox1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001243562.1 Gene:atox1 / 558347 ZFINID:ZDB-GENE-120720-2 Length:67 Species:Danio rerio


Alignment Length:70 Identity:35/70 - (50%)
Similarity:49/70 - (70%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
            ||.|||.|:|||.||:.||.|||.||.   .|.:|:|.::.|.:.|:.::|.|:|.|:||||:.|
Zfish     1 MTTHEFFVDMTCEGCSGAVTRVLNKLD---VKFDIDLPNKKVFIESDKNTDVLLETLKKTGKTVT 62

  Fly    66 YVGVK 70
            |:|.|
Zfish    63 YIGTK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 26/56 (46%)
atox1NP_001243562.1 HMA 10..62 CDD:238219 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11762
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5321
OMA 1 1.010 - - QHG50019
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto41334
orthoMCL 1 0.900 - - OOG6_103475
Panther 1 1.100 - - LDO PTHR46365
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R124
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.