DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and ccs

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_001191151.2 Gene:ccs / 550489 ZFINID:ZDB-GENE-050417-322 Length:267 Species:Danio rerio


Alignment Length:72 Identity:24/72 - (33%)
Similarity:37/72 - (51%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGV 69
            ||.|:|:|..|.:||:.||.| ...|:.|.:||....|.|.:.|:|.::...:..||:.....|:
Zfish    10 EFAVQMSCDSCVNAVKAVLEK-DPGVQSVQVNLSKEEVLVETALTSLQVQTLIESTGRRAVLKGM 73

  Fly    70 KKXDEFL 76
            ...|..|
Zfish    74 GGSDSDL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 20/56 (36%)
ccsNP_001191151.2 PLN02957 9..247 CDD:215516 24/72 (33%)
HMA 10..68 CDD:238219 21/58 (36%)
Cu-Zn_Superoxide_Dismutase 83..221 CDD:238186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.