DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and ATOX1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_004036.1 Gene:ATOX1 / 475 HGNCID:798 Length:68 Species:Homo sapiens


Alignment Length:70 Identity:35/70 - (50%)
Similarity:48/70 - (68%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTT 65
            |..|||.|:|||||||.||.|||.|||.  .|.:|:|.::.|.:.|..|.|.|:..|:||||:.:
Human     1 MPKHEFSVDMTCGGCAEAVSRVLNKLGG--VKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVS 63

  Fly    66 YVGVK 70
            |:|::
Human    64 YLGLE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 29/56 (52%)
ATOX1NP_004036.1 HMA 5..63 CDD:238219 31/59 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10936
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5322
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50019
OrthoDB 1 1.010 - - D1564517at2759
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto89590
orthoMCL 1 0.900 - - OOG6_103475
Panther 1 1.100 - - LDO PTHR46365
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R124
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.