powered by:
Protein Alignment Atox1 and AT4G23882
DIOPT Version :9
Sequence 1: | NP_001262184.1 |
Gene: | Atox1 / 326216 |
FlyBaseID: | FBgn0052446 |
Length: | 89 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_974601.1 |
Gene: | AT4G23882 / 2745722 |
AraportID: | AT4G23882 |
Length: | 284 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 17/56 - (30%) |
Similarity: | 26/56 - (46%) |
Gaps: | 1/56 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 CGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYV 67
|.||.:..:|.|..:.. |..|..|.|...::||.:.:...|:.:|.|.||....|
plant 89 CKGCQTKAKRKLLNVSG-VSTVEYNAEQGLLTVTGDANPTTLLHKLTKWGKKAELV 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Atox1 | NP_001262184.1 |
HMA |
5..62 |
CDD:238219 |
14/49 (29%) |
AT4G23882 | NP_974601.1 |
HMA |
89..141 |
CDD:238219 |
16/52 (31%) |
CTNNB1_binding |
<217..275 |
CDD:285538 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1603 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.