DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and atx1

DIOPT Version :10

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_595443.1 Gene:atx1 / 2540012 PomBaseID:SPBC1709.10C Length:68 Species:Schizosaccharomyces pombe


Alignment Length:60 Identity:27/60 - (45%)
Similarity:42/60 - (70%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQ-LRKTGK 62
            ::|.|.|.|.||.:|::|||.:||  ||..:|::|.:.|.||:: ...||:|| ::||||
pombe     3 YQFNVAMACDGCKNAIDRVLTRLG--VEDKSISVEKQEVIVTTD-KPYELVEQTIKKTGK 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 CopZ 1..61 CDD:442020 24/57 (42%)
atx1NP_595443.1 HMA 9..62 CDD:238219 25/54 (46%)

Return to query results.
Submit another query.