DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and cuc-1

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_498707.1 Gene:cuc-1 / 176102 WormBaseID:WBGene00000835 Length:69 Species:Caenorhabditis elegans


Alignment Length:63 Identity:30/63 - (47%)
Similarity:49/63 - (77%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTVHEFKVEMTCGGCASAVERVLGKLG-DKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGK 62
            ||.:.|::.|||.|||:|..:|||||| ||::..:||:|.:.::||::|.:.:::|.|:||||
 Worm     1 MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKKTGK 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 26/57 (46%)
cuc-1NP_498707.1 HMA 9..64 CDD:238219 27/55 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6884
eggNOG 1 0.900 - - E1_KOG1603
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3961
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50019
OrthoDB 1 1.010 - - D1564517at2759
OrthoFinder 1 1.000 - - FOG0005753
OrthoInspector 1 1.000 - - oto20158
orthoMCL 1 0.900 - - OOG6_103475
Panther 1 1.100 - - LDO PTHR46365
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R124
SonicParanoid 1 1.000 - - X3080
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.