DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atox1 and Ccs

DIOPT Version :9

Sequence 1:NP_001262184.1 Gene:Atox1 / 326216 FlyBaseID:FBgn0052446 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_058588.1 Gene:Ccs / 12460 MGIID:1333783 Length:274 Species:Mus musculus


Alignment Length:80 Identity:27/80 - (33%)
Similarity:40/80 - (50%) Gaps:8/80 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFKVEMTCGGCASAVERVL-GKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVG 68
            ||.|:|:|..|..||.:.| |..|  |:.|::.||::.|.|.:.|.|.|:...|..||:.....|
Mouse    15 EFAVQMSCQSCVDAVHKTLKGVAG--VQNVDVQLENQMVLVQTTLPSQEVQALLESTGRQAVLKG 77

  Fly    69 VKKXDEFLSKFQKYG 83
            :..     |:.|..|
Mouse    78 MGS-----SQLQNLG 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atox1NP_001262184.1 HMA 5..62 CDD:238219 22/57 (39%)
CcsNP_058588.1 PLN02957 13..253 CDD:215516 27/80 (34%)
HMA 15..73 CDD:238219 23/59 (39%)
Superoxide dismutase-like 88..234 27/80 (34%)
Cu-Zn_Superoxide_Dismutase 89..227 CDD:238186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.