DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and AT5G42320

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:345 Identity:82/345 - (23%)
Similarity:149/345 - (43%) Gaps:79/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRNYH----LEYKVLIEDLAPLVHAQRAENLRKKLL----------------IQWPHIDVLSAFY 45
            ||..|    :.|.|.:  |:||:           ||                |.|      ..::
plant     1 MRRRHHFPLISYAVFL--LSPLL-----------LLLVLGETNPSDSSFVTPINW------DLYH 46

  Fly    46 THSEINDYLDSLLERFPKRVQVKQF-----GWSYERRPLKVLTITNG----DGRRNKPVILIDGT 101
            :..::.:.:.||:.|.|.::.::..     |::.|   :.|:|...|    |.|.|..::|..|.
plant    47 SSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAE---VNVVTYCRGGKESDDRSNFRILLTFGQ 108

  Fly   102 VHAREWISPSMALYII-----QQLLDNYGDNQELLQD-YDWVI---MPVVNADGYEYTHTDSRYW 157
             |.||.|:..:|..|:     :|.|.|  .|..:|:: .|.::   :|:.|.:|.:...:.....
plant   109 -HGRELITSELAFRILSILSEEQFLPN--KNGGILKNTLDKLVIKMVPIENPNGRKRVESGDLCE 170

  Fly   158 RKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRL 222
            |::.|        |.|:|||:|.:||..| ...||.|. ..|..||.:.|:|::|.:.:.:...:
plant   171 RRNGR--------GVDLNRNWGVDWGKKE-KDYDPSEE-NPGTAPFSEPETQIMRKLAISFDPHI 225

  Fly   223 NFYLSLHSYGNYFLLPWGYTSDFPD--TYQDMMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSG 285
              ::::||......:|:.:.:..|:  ..|.|.::.:...|...:....|.|.|.:  |.|...|
plant   226 --WINVHSGMEALFMPYDHKNITPEGLPSQKMRTLLEKLNKFHCHDRCMIGSGGGS--VGYLAHG 286

  Fly   286 DTTDFAFGVVNATVAMTMEL 305
            ..||:.:.||.|.:|.|.|:
plant   287 TATDYIYDVVKAPMAFTFEI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 70/282 (25%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 58/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.