DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and AGBL2

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:270 Identity:60/270 - (22%)
Similarity:98/270 - (36%) Gaps:81/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IQWPHIDVLSAF------YTHSEINDYLDSLLERFPKRVQ---VKQFGWSYERRPLKVLTITNGD 88
            ||:|: |..:.|      ||::::..||.|:... |.:.|   ::....|.....:.:|||||..
Human   381 IQFPY-DQDTCFFAHFYPYTYTDLQCYLLSVANN-PIQSQFCKLQTLCRSLAGNTVYLLTITNPS 443

  Fly    89 GRRN----KPVILIDGTVHARE----WISPSMALYIIQQLLDNYGDNQELLQDYDWVIMPVVNAD 145
            ....    |..:::...||..|    |:......:|    |.|..|.|.|...:.:.::|::|.|
Human   444 QTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFI----LSNSPDAQLLRDIFVFKVLPMLNPD 504

  Fly   146 GYEYTHTDSRYWRKSRRPTSNPEC--IGTDINRNFGYEWGHDEGSSSDPC----ENIYRGERPFD 204
            |.               ...|..|  .|.|:||::     ......|.||    .|:.:  |..:
Human   505 GV---------------IVGNYRCSLAGRDLNRHY-----KTILKESFPCIWYTRNMIK--RLLE 547

  Fly   205 QSESQVLRDVMLHYKGRLNFYLSLHSY---GNYFLLP--------WGYTSDFPDTYQDMMSVADA 258
            :      |:|:|        |...|.:   .|.||..        |.:...||     :|...:|
Human   548 E------REVLL--------YCDFHGHSRKNNIFLYGCNNNNRKYWLHERVFP-----LMLCKNA 593

  Fly   259 GAKAIIYSTN 268
            ..|...:|.|
Human   594 PDKFSFHSCN 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 56/259 (22%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 52/243 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.