DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Agbl3

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:94/275 - (34%) Gaps:90/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QWPHIDVLSAF-----YTHSEINDYL-----DSLLERFPKRVQVKQFGWSYERRPLKVLTIT--- 85
            |:||......|     ||:|.:.:||     |.:..:|.|   ::....:..|..:.|||||   
Mouse   290 QFPHSQDTCYFAHCYPYTYSNLQEYLSGINSDPVRSKFCK---IRVLCHTLARNMVYVLTITTPL 351

  Fly    86 -NGDGRRNKPVILIDGTVHARE----WISPSMALYIIQQLLDNYGDNQE--LLQD-YDWVIMPVV 142
             ..|.:|.  .:::...||..|    ||......||:       ||:.:  ||:| :.:.::|::
Mouse   352 KTSDSKRK--AVILTARVHPGETNSSWIMKGFLDYIL-------GDSSDARLLRDTFIFKVVPML 407

  Fly   143 NADGYEYTHTDSRYWRKSRRPTSNPEC--IGTDINRN--------FGYEW--------------- 182
            |.||.               ...|..|  .|.|:|||        |...|               
Mouse   408 NPDGV---------------IVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMINRLMEKREV 457

  Fly   183 -------GHD----------EGSSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHS 230
                   ||.          :|||....:.:|..:|.|....|:...::......:.|...|...
Mouse   458 ILYCDLHGHSRKQNIFMYGCDGSSRSKTKGLYLQQRIFPLMLSKNCPNIFSFSACKFNVQKSKEG 522

  Fly   231 YGNYFLLPWGYTSDF 245
            .|...:...|..:.|
Mouse   523 TGRVVMWKMGIRNSF 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 56/265 (21%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 51/250 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.