DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Cpo

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:322 Identity:78/322 - (24%)
Similarity:127/322 - (39%) Gaps:103/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YLDSLLERFPKRVQVKQFGWSYERRPLKVL------TITNGDGRRNKPVILIDGTVHAREWISPS 111
            |.:.|.:.|.:        .:||..|:..|      ::|:.:   :|..|.||..:||..||:|:
  Rat    43 YAEVLTQHFLR--------MTYETWPMHYLKESAEISLTSSN---SKKTIWIDCGIHASRWIAPA 96

  Fly   112 MALYIIQ-----------------------------------------QLLDNYGDNQ---ELLQ 132
            ...:.::                                         |:|.|..|:.   .||:
  Rat    97 FCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPLQILQNDKDSARIGRLLK 161

  Fly   133 DYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPE-C--IGTDINRNFGYEWGHDEGSSSDPCE 194
            :.|:.   |:||||..||.|.:  |   ..|..... |  |||.||                 |:
  Rat   162 ELDFX---VLNADGXIYTWTTA--W---TLPVGQGYLCLHIGTPIN-----------------CQ 201

  Fly   195 NI-YRGERPFDQSE---SQVLRDVMLHYKGRLNF--YLSLHSYGNYFLLPWGYTSDFPDTYQDMM 253
            :: :.|..|..:.|   ||.|:..    :|:.:.  :|.:.|||...|.|:|:|.:.|..|::::
  Rat   202 DVTFCGIEPMLEPELTPSQALQKA----RGKKDILCFLIMGSYGQLILTPYGHTKNKPHNYEELI 262

  Fly   254 SVADAGAKAI--IYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGF 313
            .|....|:|:  .:.||  |..||...:||..||.:.|:..|:.....:.|.||...|..||
  Rat   263 QVGQKAARALKAKHGTN--YRVGSGADILYMLSGSSKDWNGGIGIPLFSYTFELVDNGTHGF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 78/322 (24%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 78/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.