DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and cpb2

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001025617.1 Gene:cpb2 / 595005 XenbaseID:XB-GENE-969491 Length:421 Species:Xenopus tropicalis


Alignment Length:341 Identity:103/341 - (30%)
Similarity:177/341 - (51%) Gaps:19/341 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRVQVKQFGW 72
            |.||:.:...|:..|...:...    |.........::|..:|..::..::|:....:|....|:
 Frog    90 YMVLVNNAQELIEQQTFNDTSN----QRSATSFYEQYHTLEDIYYWMQHMVEKHSDMLQRIHIGY 150

  Fly    73 SYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYG---DNQELLQDY 134
            |:|.|||.||.: :|..:..|..:.||..:||||||||:..|:.:...::.||   ...:||:..
 Frog   151 SFENRPLYVLKV-SGKEKTAKHAVWIDCGIHAREWISPAFCLWFVGHAVEYYGVDLSMTKLLRYL 214

  Fly   135 DWVIMPVVNADGYEYTHT-DSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSSDPCENIYR 198
            |:.|:||:|||||:::.| .:|.|||:|...:...|||||:||||...| ...|:|||||..||.
 Frog   215 DFYILPVMNADGYQFSWTAKNRMWRKNRSKYTKSNCIGTDLNRNFDAGW-CGPGASSDPCHEIYC 278

  Fly   199 GERPFDQSESQVLRDV--MLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSVADAGAK 261
            |  |:.:||.:|...|  :..::..:..|:::|||....|.|:.||:.....:.:::.::...|:
 Frog   279 G--PYAESEPEVSAVVSFLKKHQNVVKGYITVHSYSQMVLFPYSYTNKKSKDHDELLLLSKKVAE 341

  Fly   262 AIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGF--DPWISQIERLV 324
            .|..::...|.||:....:|...|.:.|:|:. :....:.|.||...|..||  .|.:  |:...
 Frog   342 GIRSTSRNKYMYGAGAETIYLAPGGSDDWAYD-LGIKYSFTFELRDKGMYGFLLPPQL--IKPTC 403

  Fly   325 TESWVGVRAMAAEVIR 340
            :|....|:.:||.:::
 Frog   404 SEGITAVKIIAAHIVK 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 97/301 (32%)
cpb2NP_001025617.1 Propep_M14 33..104 CDD:366995 4/13 (31%)
M14_CPB2 118..418 CDD:349465 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.