DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Cpa4

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001102816.1 Gene:Cpa4 / 502736 RGDID:1563619 Length:421 Species:Rattus norvegicus


Alignment Length:347 Identity:103/347 - (29%)
Similarity:177/347 - (51%) Gaps:19/347 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAE---NLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFP 62
            :::..|:|.|.|::|..|:..:..|   |..::....:.:    .::::...|...:||:...||
  Rat    80 LKSQGLDYSVTIDNLQALLDIEDEEMQHNEGRERSGDFNY----GSYHSPEAIYHEMDSIATDFP 140

  Fly    63 KRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDN 127
            ......:.|.::|:||:.||..:.|.|.:.:|.|.::..:|||||||.:.|::..::::.:|..:
  Rat   141 DLASRVKIGETFEKRPMYVLKFSTGGGGKKRPAIWLNAGIHAREWISQATAIWTARKIVTDYQKD 205

  Fly   128 ---QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSS 189
               ..:|:..|..::||.|.|||.||...:|.|||:|.......|||.|.|||:...:. .||:|
  Rat   206 PAVTSILEKMDIFLLPVANPDGYVYTQNQNRLWRKTRSRNPGSRCIGADPNRNWNASFA-GEGAS 269

  Fly   190 SDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYT-SDFPDTYQDMM 253
            ::||..:|.|..|..:.|.:.:.| .:...|....::.||||....:.|:||: ...||. :::.
  Rat   270 NNPCSEVYHGSHPNSEVEVKSVVD-FIQKHGNFKCFIDLHSYSQLLMYPYGYSVKKAPDA-EELD 332

  Fly   254 SVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAF--GVVNATVAMTMELPAAGFQGFDPW 316
            .||.:.|||:...:...|..|.|...:||.||.:.|:|:  |:   ..|.|.||...|..||...
  Rat   333 DVARSAAKALASLSGTKYQVGPTCTTVYPASGSSVDWAYDNGI---KYAFTFELRDTGHYGFLLP 394

  Fly   317 ISQIERLVTESWVGVRAMAAEV 338
            .|||.....|:|.|::.:...|
  Rat   395 ASQIIPTAEETWQGLKVIMEHV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 94/299 (31%)
Cpa4NP_001102816.1 Propep_M14 28..99 CDD:280416 6/18 (33%)
Peptidase_M14_like 117..419 CDD:299699 95/310 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.