DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and cpb1

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:345 Identity:105/345 - (30%)
Similarity:168/345 - (48%) Gaps:33/345 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLD-------SLLERFPK 63
            :.|::||.||...:..||..|:|              |.:::.:.|| ||       ::..:.|.
 Frog    86 MPYEILINDLQDALEKQRDSNIR--------------AVHSYEKYND-LDTINAWSANIAAQNPG 135

  Fly    64 RVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQ 128
            .|.....|.||:.||:.:|.:  |....||..:.||...||||||||:...:.:::.:..||...
 Frog   136 LVSRSSIGTSYQGRPIYLLKV--GKSGANKKAVFIDCGFHAREWISPAFCQWFVKEAVSAYGVES 198

  Fly   129 E---LLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSSS 190
            |   ||.:.|..::||:|.|||.||.|.:|.|||:|....|..|||||.||||...| ...|:|:
 Frog   199 EFTSLLDNLDIYVLPVLNVDGYVYTWTTNRMWRKTRSANPNSTCIGTDPNRNFNAGW-CTAGAST 262

  Fly   191 DPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDMMSV 255
            ..|:..|.|..|..:.|::.|.:.:......:..||::|||....|.|:.|:......:.::.:|
 Frog   263 RACDETYCGSAPESEPETKALANFIRANIPAIKGYLTIHSYSQMLLFPYSYSYAVAKDHNELNAV 327

  Fly   256 ADAGAKAI--IYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDPWIS 318
            |.....::  :|.|.  |:||.....:|..:|.:.|:|:. .....:.|.||...|..||....|
 Frog   328 AQGAVNSLTSLYKTK--YTYGPGGSTIYLAAGGSDDWAYD-AGVKFSYTFELRDTGRYGFALPES 389

  Fly   319 QIERLVTESWVGVRAMAAEV 338
            ||:....|:.:.|:.:|:.:
 Frog   390 QIKPTCEETMLAVKYIASYI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 95/305 (31%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 5/15 (33%)
M14_CPB 111..410 CDD:349443 95/306 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.