DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and cpa2

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001003446.2 Gene:cpa2 / 445052 ZFINID:ZDB-GENE-040801-182 Length:422 Species:Danio rerio


Alignment Length:343 Identity:107/343 - (31%)
Similarity:171/343 - (49%) Gaps:19/343 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRV 65
            ::..::.:.|:|.::..|:..:|||.:....:.:.......:|::....|..::|:|:......:
Zfish    77 LKENNISFSVMINNVQELLDRERAEMVSNTEMERNTKSFNFAAYHDLDTIYSFMDTLVASHSNLI 141

  Fly    66 QVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGDNQEL 130
            ...:.|.:||.||:.||..:.|.  .|||.|.||..:|||||:|.:.|::|..::..::.:|:.|
Zfish   142 SKVKIGSTYENRPMYVLKFSTGG--ENKPAIWIDAGIHAREWVSHASAVWIADRIATDFKENRAL 204

  Fly   131 ----LQDYDWVIMPVVNADGYEYTHTD----SRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEG 187
                |...|..:|.|.|.|||.::|..    .|.|||||..||||.|.|.|:||||..|:. ..|
Zfish   205 ARNVLSKMDIYLMIVANPDGYVFSHLTVRPFHRLWRKSRSVTSNPNCPGVDLNRNFDAEFS-GPG 268

  Fly   188 SSSDPCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYT-SDFPDTYQD 251
            :|.|||...|||.....:.|...:.|.:|.: |....:::||:|....:.|:||| |:.|| ..|
Zfish   269 ASDDPCAEDYRGPSAHSEIEVTNIADFILSH-GNFKSFMTLHAYSQLLMYPYGYTGSNAPD-QPD 331

  Fly   252 MMSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAF--GVVNATVAMTMELPAAGFQGFD 314
            :..||....||:......||..||.::.:...||.:.|:|:  |:   ......||...|..||.
Zfish   332 LHDVATQANKALNSWHGTIYKVGSIFHTIEQASGASVDWAYQHGI---KYCFAFELRDTGEYGFL 393

  Fly   315 PWISQIERLVTESWVGVR 332
            ....||.....|:|..:|
Zfish   394 LPADQIVSTARETWFALR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 100/300 (33%)
cpa2NP_001003446.2 Propep_M14 27..97 CDD:280416 3/19 (16%)
Peptidase_M14_like 115..420 CDD:299699 101/305 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593443
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.