DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and CG12374

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster


Alignment Length:344 Identity:108/344 - (31%)
Similarity:187/344 - (54%) Gaps:31/344 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDS--LLERFPKRVQVKQF 70
            |:|:::||..|:.   ..::.....::|      ..::|...|.|::|.  ....|   ::.|..
  Fly    91 YEVIVDDLQKLID---ESSVGDDSQMEW------ETYHTLDTIYDWIDQECAAHDF---LECKVI 143

  Fly    71 GWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYG-DNQELLQDY 134
            |.|||.|.:|.:.::...|.:   .|.::|.:||.||||.:...:::.||:::.. :.|.|.::|
  Fly   144 GQSYEGRDIKSIRLSKRSGNK---AIFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQRLSEEY 205

  Fly   135 DWVIMPVVNADGYEYTHTDSRYWRKSRRP----TSNPECIGTDINRNFGYEWGHDEGSSSDPCEN 195
            ||:::|:||.||:.|||...|.|||:|||    ..:.:|.|.|:||||.|.||....:..:||::
  Fly   206 DWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNFDYHWGGAGWNIDEPCDH 270

  Fly   196 IYRGERPFDQSESQVLRDVMLHYK-GRLNFYLSLHSYGNYFLLPWGYT-SDFPDTYQDMMSVADA 258
            .:.||.|..:.|...|::.:..:: |.:..|::.|:||.|.|||:|:: ::||..|:.|..:|.|
  Fly   271 WFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSNTEFPPNYEQMKRIAAA 335

  Fly   259 --GAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGFDPWISQIE 321
              .|.|.:|.:.  ::||::..:.|..||...|:|:||.......|:||...|..||....:||.
  Fly   336 FSDAAADVYGST--FTYGASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKGTFGFFLPSNQIT 398

  Fly   322 RLVTESWVGVRAM---AAE 337
            .:..|...|::|:   |||
  Fly   399 EVGLEVTAGLKALVNKAAE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 102/308 (33%)
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 5/15 (33%)
M14_CP_A-B_like 118..415 CDD:199844 99/304 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466999
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.