DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32379 and Agbl5

DIOPT Version :9

Sequence 1:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_038968402.1 Gene:Agbl5 / 362710 RGDID:1598311 Length:901 Species:Rattus norvegicus


Alignment Length:451 Identity:80/451 - (17%)
Similarity:147/451 - (32%) Gaps:157/451 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYHLEYKVLIEDLAPLVHA----QRAENLRKKLLIQWPHIDVLSAF------------------- 44
            |.:.:.|:..:.:||.|..    .|.|.:|::...:......:.:|                   
  Rat    94 NMNKQSKLYSQGMAPFVRTLPSRPRWERIRERPTFEMTETQFVLSFVHRFVEGRGATTFFAFCYP 158

  Fly    45 YTHSEINDYLDSLLERFPKRVQV------------KQFGWSYERRPLKVLTITNGDGRRN----- 92
            :::|:..|.|..|.:|||:....            :...:|.:...:.:||||:..|.|:     
  Rat   159 FSYSDCQDLLSQLDQRFPENYSAHSSPLDSIYYHRELLCYSLDGLRVDLLTITSCHGLRDDREPR 223

  Fly    93 ------------------KPVILIDGTVHAREWISPSMALYIIQQLLD-----NYGDNQELLQDY 134
                              |.:..:...||..|  :||.  ::....||     :....|.|.:.:
  Rat   224 LEQLFPDVGTPRPFRFTGKRIFFLSSRVHPGE--TPSS--FVFNGFLDFILRPDDPRAQTLRRLF 284

  Fly   135 DWVIMPVVNADGYEYTH--TDSR-------------------YWRK-------------SRRPTS 165
            .:.::|::|.||....|  ||||                   |..|             |:.|::
  Rat   285 VFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSKNPSN 349

  Fly   166 N--------PECIGTDINR--NFGYEW---------GHDEGSSSDPCEN----IYRGERPFDQSE 207
            .        ||...:|:.:  |...|.         .||..:.::|.|.    ::...:|..:.|
  Rat   350 QQPSSLHLPPEVPLSDLEKANNLHNELHLGQSPDGENHDRWTETEPTEEKTDPVWIMPQPIPELE 414

  Fly   208 SQVLRDVMLHYKGRLNFYLSLHS---------YGNYFLLPWGYTSDFPDTYQDM-------MSVA 256
             :...|.:...:..:.:|:.||.         |||.|       ||.....::|       ::.|
  Rat   415 -EPAPDAIPPKESGVAYYVDLHGHASKRGCFMYGNSF-------SDESTQVENMLYPKLISLNSA 471

  Fly   257 DAGAKAIIYSTNGIYS---------YGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAA 308
            ....:...:|...:|:         .||....:|..||....:.......|......:|||
  Rat   472 HFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAA 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 72/406 (18%)
Agbl5XP_038968402.1 Pepdidase_M14_N 10..155 CDD:407865 9/60 (15%)
M14_AGBL5_like 183..575 CDD:349455 64/362 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.